Protein Info for MMJJ_RS07200 in Methanococcus maripaludis JJ

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 75 to 93 (19 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details amino acids 202 to 227 (26 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 269 to 286 (18 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details amino acids 325 to 349 (25 residues), see Phobius details amino acids 355 to 373 (19 residues), see Phobius details PF07690: MFS_1" amino acids 13 to 309 (297 residues), 43.9 bits, see alignment E=8e-16

Best Hits

KEGG orthology group: None (inferred from 98% identity to mmp:MMP1389)

Predicted SEED Role

"Permease of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (382 amino acids)

>MMJJ_RS07200 MFS transporter (Methanococcus maripaludis JJ)
MIEIKKNPMYNYLFFLIVAAAISHQVWGTLFNNFAVDVVGINGFQMGLIQSIREIPGFLT
FLVIYVLLVIKEHRLSALSTILMGFGVAITGLFPTVQGLIITTFLMSLGFHYFETTNKSL
TLQHFNKKEAPVVFGRFSSYGAIASIIAGFFIWLSVKLLPIWTNYLIYGIVIMLIGVYSL
FKNPIFKETVPQRKGMVVKKKYWLYYVLNFLSGARRQIFIAFAVFLLVQNYGFSVSEVAV
LFVLNNLLIYFTAPKVAEGINNLGERKMLTIEYVTLTFVFLGYAFIENRNIAVLLYIIDH
IVFSFAIGINTYFQKTADSEDIAPSMGVGFAINHISAVIIPVVGGILWMANWKTPFIMGA
VFSVISLFFVQKIPKHIKILQN