Protein Info for MMJJ_RS07160 in Methanococcus maripaludis JJ

Annotation: M20 family metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01910: peptidase, ArgE/DapE family
  • amino acids 9 to 409 (401 residues), 251.8 bits, E=6.3e-79
• PF01546: Peptidase_M20
  • amino acids 86 to 414 (329 residues), 108.6 bits, E=4.2e-35
• PF07687: M20_dimer
  • amino acids 196 to 303 (108 residues), 64.5 bits, E=7.8e-22

Best Hits

Swiss-Prot: 95% identical to Y1398_METMP: Uncharacterized metallohydrolase MMP1398 (MMP1398) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01439, succinyl-diaminopimelate desuccinylase [EC: 3.5.1.18] (inferred from 95% identity to mmp:MMP1398)

Predicted SEED Role

"Acetylornithine deacetylase (EC 3.5.1.16)" in subsystem Arginine Biosynthesis extended (EC 3.5.1.16)

MetaCyc Pathways

• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-lysine biosynthesis I (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• superpathway of arginine and polyamine biosynthesis (13/17 steps found)
• aspartate superpathway (18/25 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Lysine biosynthesis
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.16 or 3.5.1.18

Protein Sequence (415 amino acids)

>MMJJ_RS07160 M20 family metallo-hydrolase (Methanococcus maripaludis JJ)
MKSILDETIELSSDLISINSVNPTFGGIGEKEKSIYIKNKLKEYRYMYSIKNCEIIEYNS
VDSDGIERPNIVSKYDFGKKDTLTIISHMDIVPEGDLSLWNSNPFKAEIKDGIIYGRGSE
DNHKGIVSSFLLLKMIFEEKIDPKYNLNLIFVADEEDGSKYGLSYLVNNFEDELFGSKDL
IIVPDFGMPEGEFIEIAEKNILWIKFKITGKQCHGSVPENGINADLIAFSFGKGLYDKLY
GKYTGINPIFNPAFSTFEPTILKNNIENINTIPGYVELNFDCRIIPKYDPKEILNDIENY
IEVFKNEIEKHILHFDISEKENISITYEILKLEKAEETKKDSEVVKKLGSAIKNVLNKEP
ILCGMGGGTVAAFLREKEYNTAVWGIGDETAHQPNEHVKIENLIKMAEVYLDILK