Protein Info for MMJJ_RS07155 in Methanococcus maripaludis JJ
Annotation: [5-(aminomethyl)furan-3-yl]methyl phosphate kinase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 51% identical to MFNE_METJA: [5-(aminomethyl)furan-3-yl]methyl phosphate kinase (mfnE) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)
KEGG orthology group: K07144, (no description) (inferred from 97% identity to mmp:MMP1399)MetaCyc: 51% identical to [5-(aminomethyl)furan-3-yl]methyl phosphate kinase (Methanocaldococcus jannaschii)
RXN-15944 [EC: 2.7.4.31]
Predicted SEED Role
"delta 1-pyrroline-5-carboxylate synthetase"
MetaCyc Pathways
- methanofuran biosynthesis (4/8 steps found)
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.4.31
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (212 amino acids)
>MMJJ_RS07155 [5-(aminomethyl)furan-3-yl]methyl phosphate kinase (Methanococcus maripaludis JJ) MVVVYVVKIGGSLTNNAVNILENLKKSGEKVVIMPGGGNFANVVRNLHENEKINDISAHK LATMCTDITGTYFSEISGIKTADNLFDAKKILRDESIVIILPSNIILSTDELPYSWEVTS DSFAAYIAKLLNSKTLIIATDVDGIYDKYPEGKLLNTINTKTIKGFTSVDKHLPKLISEY GIKCFVVNGNHPERINNIFKGVVDTYTKITLK