Protein Info for MMJJ_RS07050 in Methanococcus maripaludis JJ
Annotation: 50S ribosomal protein L30
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to RL30_METMP: 50S ribosomal protein L30 (rpl30) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K02907, large subunit ribosomal protein L30 (inferred from 100% identity to mmp:MMP1420)Predicted SEED Role
"LSU ribosomal protein L7e (L30p)" in subsystem Ribosome LSU eukaryotic and archaeal
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (154 amino acids)
>MMJJ_RS07050 50S ribosomal protein L30 (Methanococcus maripaludis JJ) MAYAVVRVRGSVGVRGDIADTMKMLRLHRVNHCVIIPDTEHYTGMIKKVKDYVTYGEIDK DTLVALILKRGRLPGNKRLSEELVKELTELPVEELAEKVIAGEIKIKDTPIKPVFRLHPP RKGYDRAGVKKGFSIGGALGYRSGKINDLLNKMM