Protein Info for MMJJ_RS07035 in Methanococcus maripaludis JJ
Annotation: glycosyl transferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01001, UDP-N-acetylglucosamine--dolichyl-phosphate N-acetylglucosaminephosphotransferase [EC: 2.7.8.15] (inferred from 97% identity to mmp:MMP1423)Predicted SEED Role
"Undecaprenyl-phosphate N-acetylglucosaminyl 1-phosphate transferase (EC 2.7.8.-)" in subsystem Methicillin resistance in Staphylococci or Teichoic and lipoteichoic acids biosynthesis (EC 2.7.8.-)
MetaCyc Pathways
- Escherichia coli serotype O:15 O antigen biosynthesis (1/5 steps found)
- Salmonella enterica serotype O:54 O antigen biosynthesis (1/5 steps found)
- enterobacterial common antigen biosynthesis (1/5 steps found)
- Escherichia coli serotype O:149/Shigella boydii serotype O1 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:177 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:50 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:56 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:77/Salmonella enterica serotype O:6,14 O antigen biosynthesis (1/6 steps found)
- Salmonella enterica serotype O:13 O antigen biosynthesis (1/6 steps found)
- Escherichia coli serotype O:111/Salmonella enterica serotype O:35 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:152 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:157/Salmonella enterica serotype O:30 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:1B/Salmonella enterica serotype O:42 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:2 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:7 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:71/Salmonella enterica serotype O:28ac O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:85/Salmonella enterica serotype O:17 O antigen biosynthesis (1/7 steps found)
- Salmonella enterica serotype O:18 O antigen biosynthesis (1/7 steps found)
- Salmonella enterica serotype O:39 O antigen biosynthesis (1/7 steps found)
- Salmonella enterica serotype O:6,7 O antigen biosynthesis (1/7 steps found)
- Escherichia coli serotype O:104 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:107 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:117 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:127 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:128 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:21/Salmonella enterica serotype O:38 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:49 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:51/Salmonella enterica serotype O:57 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:52 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:55/Salmonella enterica serotype O:50 O antigen biosynthesis (1/8 steps found)
- Escherichia coli serotype O:86 O antigen biosynthesis (1/8 steps found)
- Shigella boydii serotype 6 O antigen biosynthesis (1/8 steps found)
- poly(3-O-β-D-glucopyranosyl-N-acetylgalactosamine 1-phosphate) wall teichoic acid biosynthesis (2/10 steps found)
- superpathway of enterobacterial common antigen biosynthesis (2/10 steps found)
- Escherichia coli serotype O:169 O antigen biosynthesis (1/9 steps found)
- Escherichia coli serotype O:183/Shigella boydii serotype O:10 O antigen biosynthesis (1/9 steps found)
- Escherichia coli serotype O:8 O antigen biosynthesis (1/9 steps found)
- poly(glycerol phosphate) wall teichoic acid biosynthesis (2/11 steps found)
- Escherichia coli serotype O:9 O antigen biosynthesis (1/10 steps found)
- Escherichia coli serotype O:9a O antigen biosynthesis (1/10 steps found)
- poly(ribitol phosphate) wall teichoic acid biosynthesis I (B. subtilis) (2/12 steps found)
- poly(ribitol phosphate) wall teichoic acid biosynthesis II (S. aureus) (2/14 steps found)
- protein N-glycosylation initial phase (eukaryotic) (2/19 steps found)
- H. pylori 26695 O-antigen biosynthesis (1/21 steps found)
KEGG Metabolic Maps
- Aminophosphonate metabolism
- Glycerophospholipid metabolism
- High-mannose type N-glycan biosynthesis
- N-Glycan biosynthesis
- Nucleotide sugars metabolism
- Sphingolipid metabolism
Isozymes
No predicted isozymesUse Curated BLAST to search for 2.7.8.- or 2.7.8.15
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (299 amino acids)
>MMJJ_RS07035 glycosyl transferase (Methanococcus maripaludis JJ) MDLYFVLSALFSFVISLIFTKFMIKKMVNYKYGYDLHKADKIKVAEMGGLSPVVVSSVVM LFFNPAISLSIFLPGFVGVIDDISRLNSKEKIVLTFLIGFPVAFFLKLGFLPSILLILGI FISSNLTNMLAGFNGLEIGMGILLCLFMAAVCLMNGDIFGFKVLILFSAAYLGLLYYNRY PAKVFPGDTGTLPIGAFLATIAVWRGFIPELFILMIPFVVDALLKQFTAGVTKKDTVFTP TKLKNGKLCVEGGYLSLPRMILMKKAMEEYKIVLVLWAIEAFFGILSILYTKYIGFNIF