Protein Info for MMJJ_RS06830 in Methanococcus maripaludis JJ

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13237: Fer4_10
  • amino acids 30 to 78 (49 residues), 30 bits, E=2.7e-10
  • amino acids 109 to 154 (46 residues), 34.4 bits, E=1.1e-11
• PF12837: Fer4_6
  • amino acids 30 to 52 (23 residues), 28.4 bits, 7.4e-10
  • amino acids 136 to 158 (23 residues), 29.5 bits, 3.2e-10
• PF00037: Fer4
  • amino acids 31 to 54 (24 residues), 30.9 bits, 1.1e-10
  • amino acids 64 to 83 (20 residues), 27.8 bits, see alignment (E = 1.1e-09)
  • amino acids 109 to 130 (22 residues), 24.6 bits, see alignment (E = 1.1e-08)
  • amino acids 137 to 159 (23 residues), 31.1 bits, 9.4e-11
• PF12800: Fer4_4
  • amino acids 35 to 50 (16 residues), 14.9 bits, see alignment (E = 1.9e-05)
  • amino acids 65 to 79 (15 residues), 12.1 bits, see alignment (E = 0.00015)
  • amino acids 112 to 127 (16 residues), 10.9 bits, see alignment (E = 0.00036)
  • amino acids 141 to 155 (15 residues), 12.7 bits, see alignment (E = 9.8e-05)
• PF12798: Fer4_3
  • amino acids 38 to 52 (15 residues), 15.6 bits, see alignment (E = 1.5e-05)
  • amino acids 67 to 81 (15 residues), 15.2 bits, see alignment (E = 2.1e-05)
  • amino acids 114 to 128 (15 residues), 13.6 bits, see alignment (E = 7.1e-05)
  • amino acids 143 to 157 (15 residues), 14.1 bits, see alignment (E = 4.9e-05)
• PF13187: Fer4_9
  • amino acids 38 to 82 (45 residues), 27.4 bits, E=1.9e-09
  • amino acids 113 to 158 (46 residues), 33.2 bits, E=2.8e-11
• PF13183: Fer4_8
  • amino acids 65 to 127 (63 residues), 27.5 bits, E=2.5e-09
• PF12838: Fer4_7
  • amino acids 66 to 128 (63 residues), 40.7 bits, E=1.7e-13

Best Hits

KEGG orthology group: None (inferred from 96% identity to mmp:MMP1464)

Predicted SEED Role

"Energy conserving hydrogenase Eha ferredoxin (protein P2)"

Protein Sequence (161 amino acids)

>MMJJ_RS06830 4Fe-4S binding protein (Methanococcus maripaludis JJ)
MIDMVSKILKKYFDNLDIKFELDSQYISNKIEINPELCILCNRCLEVCPVTAISSNFPEV
PDIDNKCVYCNTCVETCPVDAIKITKTRVRVEQGNLIIENRLKSKKLDYNRKKCVMCLVC
TKNCPFGAISESDDNISFDMDKCVLCGHCEEICPAKAIKLE