Protein Info for MMJJ_RS06565 in Methanococcus maripaludis JJ

Annotation: segregation/condensation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 222 PF02616: SMC_ScpA" amino acids 15 to 218 (204 residues), 54.5 bits, see alignment E=8.9e-19

Best Hits

Swiss-Prot: 52% identical to Y1134_METJA: Uncharacterized protein MJ1134 (MJ1134) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K05896, segregation and condensation protein A (inferred from 98% identity to mmp:MMP1516)

Predicted SEED Role

"Segregation and condensation protein A" in subsystem Two cell division clusters relating to chromosome partitioning

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (222 amino acids)

>MMJJ_RS06565 segregation/condensation protein A (Methanococcus maripaludis JJ)
MEFDLWVRIIKESIEKKDVDPWNINISEITDEYLGTIKELRKFDIRLSADVVLVAGILLR
LKSQVLYGECENAFTEEEEEVYEDDYRDEDYVEDEIVEKPQKEPVKELNPESMTLDGLIS
TLKTELKKIKDTKPRKKREVVRPTALYNLVEEMIEEDDISDIMELLVLELKKSGGKFTFQ
NKFKTREEIIKNFLPALYLANDGKIDIDQENLFDELNLELKK