Protein Info for MMJJ_RS06365 in Methanococcus maripaludis JJ

Annotation: methyl coenzyme M reductase-arginine methyltransferase Mmp10

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 TIGR03278: methanogenesis marker radical SAM protein" amino acids 25 to 424 (400 residues), 557.9 bits, see alignment E=6.1e-172 PF04055: Radical_SAM" amino acids 61 to 208 (148 residues), 61.9 bits, see alignment E=8.6e-21 PF19238: Radical_SAM_2" amino acids 149 to 217 (69 residues), 41.2 bits, see alignment E=1.4e-14

Best Hits

Swiss-Prot: 65% identical to MCRAM_METJA: [Methyl-coenzyme M reductase subunit alpha]-arginine C-methyltransferase (MJ0841) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 97% identity to mmp:MMP1554)

MetaCyc: 45% identical to [methyl-coenzyme M reductase]-arginine C-methyltransferase (Methanosarcina acetivorans)
RXN-21081 [EC: 2.1.1.379]

Predicted SEED Role

"Methyl coenzyme M reductase associated protein @ Fe-S oxidoreductase, related to NifB/MoaA family"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.379

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>MMJJ_RS06365 methyl coenzyme M reductase-arginine methyltransferase Mmp10 (Methanococcus maripaludis JJ)
MDAGFGFEDTDNNDSNDKSQLLIDLKGEPGKNCGGFCKFCYFRKVNFNNPEPLGCGQCTF
QIGCDYCTNSIREINGNFIPVPFAIEQVQNAIIFKRYEKVNITSGGDTSYYPYLEDLCKI
INEMGLKIHLGYTSGKGLKGIESAKYLVDSGVDEVTFSVFSTDPNLRKEWMNDKNPEQSL
ECLKYFCENCETHCAIIVIPGVNDGEVLKNTISDLVSWGANAVILMRFANNVENGLIFGN
EPLIEEIPVHTVEEFGTLVKEMHELFGNSVRISGTPVYDPITNTPFAICHEEEILNELRA
KIKAQATIITGNVSYIYLSKIFENTPIKVISVNKDIADLITKTDLETVDLSQVTDTVLYP
VNALVHERDAEDIFTKDGMKRIVLKGIDKLTMDGEVSGIFTKEEAIEFEVNAFNELIEKI
NFFGNPV