Protein Info for MMJJ_RS06270 in Methanococcus maripaludis JJ
Annotation: dethiobiotin synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 65% identical to BIOD_METVS: ATP-dependent dethiobiotin synthetase BioD (bioD) from Methanococcus vannielii (strain ATCC 35089 / DSM 1224 / JCM 13029 / OCM 148 / SB)
KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 92% identity to mmp:MMP1573)Predicted SEED Role
"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)
MetaCyc Pathways
- biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
- biotin biosynthesis II (5/6 steps found)
- biotin biosynthesis from 8-amino-7-oxononanoate II (3/4 steps found)
- biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)
- biotin biosynthesis I (5/15 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 6.3.3.3
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (190 amino acids)
>MMJJ_RS06270 dethiobiotin synthase (Methanococcus maripaludis JJ) MGKILKGRGVNVGYIKPIESGGVEDTTYAKTELELSEDLAVLNPINLKNPLSPNIAAAVE DVEIDIDKIKESFQKLKESHEYLIVEGAGGVCVPIKSDYLMADLIKDLNLPCVLVSRPDL GTINHTILSVEYLRNKGILVKGVIINCIDELKDIPYYEETFNAIEEFGHVEIIGVVKNKD DYSINIDKLL