Protein Info for MMJJ_RS06120 in Methanococcus maripaludis JJ

Annotation: DUF4013 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 59 to 86 (28 residues), see Phobius details amino acids 117 to 145 (29 residues), see Phobius details amino acids 157 to 182 (26 residues), see Phobius details amino acids 203 to 233 (31 residues), see Phobius details amino acids 240 to 264 (25 residues), see Phobius details PF13197: DUF4013" amino acids 69 to 226 (158 residues), 78.2 bits, see alignment E=3.3e-26

Best Hits

KEGG orthology group: None (inferred from 93% identity to mmp:MMP1604)

Predicted SEED Role

"Uncharacterized protein MJ1189"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>MMJJ_RS06120 DUF4013 domain-containing protein (Methanococcus maripaludis JJ)
MFFERYIKDPLQFAWSDPKKIFVGGVFQLISIGGIILGLLIMFASVIPSLLDIAPELALF
TSLGGILVGFIVATIGVVFTAFIYGYYMKVIENTLEGSFELPEWEDFKGLLSKGAHFFFG
IFILQLLFGIISLIVTAPFVILLMLNDGYSNVLIFNVFMNLVSFVLSAIEALYITLATIN
FVDKKEFMGFFDLKEVVSKISIEYILVIVAVALVSILVVIPVIIVLLIPVLIGIFTQNVF
LMVAIALIVLAMPFLQMFLTVFGYRSYSNYYLSKKESILEENAGTENNE