Protein Info for MMJJ_RS06095 in Methanococcus maripaludis JJ

Annotation: formylmethanofuran--tetrahydromethanopterin N-formyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01913: FTR
  • amino acids 1 to 147 (147 residues), 207.5 bits, E=8.1e-66
• TIGR03119: formylmethanofuran--tetrahydromethanopterin N-formyltransferase
  • amino acids 8 to 301 (294 residues), 471.9 bits, E=4.1e-146
• PF02741: FTR_C
  • amino acids 150 to 301 (152 residues), 220.8 bits, E=8.1e-70

Best Hits

Swiss-Prot: 75% identical to FTR_METJA: Formylmethanofuran--tetrahydromethanopterin formyltransferase (ftr) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00672, formylmethanofuran--tetrahydromethanopterin N-formyltransferase [EC: 2.3.1.101] (inferred from 99% identity to mmp:MMP1609)

MetaCyc: 61% identical to formylmethanofuran--tetrahydromethanopterin N-formyltransferase (Archaeoglobus fulgidus DSM 4304)
Formylmethanofuran--tetrahydromethanopterin N-formyltransferase. [EC: 2.3.1.101]

Predicted SEED Role

"Formylmethanofuran--tetrahydromethanopterin N-formyltransferase (EC 2.3.1.101)" in subsystem Methanogenesis (EC 2.3.1.101)

MetaCyc Pathways

• gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
• methanogenesis from H₂ and CO₂ (6/6 steps found)
• methyl-coenzyme M oxidation to CO₂ II (6/6 steps found)
• methyl-coenzyme M oxidation to CO₂ I (5/6 steps found)
• reductive acetyl coenzyme A pathway II (autotrophic methanogens) (5/6 steps found)
• methoxylated aromatic compound degradation II (6/9 steps found)
• superpathway of methanogenesis (11/21 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)

KEGG Metabolic Maps

• Folate biosynthesis
• Methane metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.101

Protein Sequence (302 amino acids)

>MMJJ_RS06095 formylmethanofuran--tetrahydromethanopterin N-formyltransferase (Methanococcus maripaludis JJ)
MELNGVVIEDTFAEGFPIWVSRVLITAATERLAKAAATEATGFACSVIMCPAEAGIEKYV
SPAETPDGRPGYIIEICHPKKAEIEHQLLERIGQCVLTAPTTAVFNAMGEDATEELKVGF
KLKYFGDGYEKKVKCEECGKTLYSIPIMGGDFLIESKLGIKKGVAGGNFFIMAENNMAAL
MAAEAAVDAISEVEKTITPFTGGIVASGSKVGYTNPKYSFMAATTNEKMCPTLKETVEGT
EIPADVNGVYEIVIDGIDEASVAAAMKAGIKAAVTIPGVKKITAGNYGGKLGPYQIKLQE
LF