Protein Info for MMJJ_RS05975 in Methanococcus maripaludis JJ

Annotation: sulfurtransferase TusA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 271 PF01206: TusA" amino acids 72 to 140 (69 residues), 54 bits, see alignment E=1.9e-18 PF02635: DsrE" amino acids 156 to 262 (107 residues), 55.9 bits, see alignment E=7e-19

Best Hits

Swiss-Prot: 65% identical to Y760_METJA: Uncharacterized protein MJ0760 (MJ0760) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07092, (no description) (inferred from 98% identity to mmp:MMP1634)

Predicted SEED Role

"Uncharacterized protein MJ0760"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (271 amino acids)

>MMJJ_RS05975 sulfurtransferase TusA family protein (Methanococcus maripaludis JJ)
MIKEINVKSLRSPAMLVEKVIENTKGGILLIETDGDSQIKEISELIKKMGYKMEVDGTNV
KVSIGEIEATKSINVVGASCPGPILMVGEVLERMAVGEILEIVAGANAFTDLTEGLKSMG
NDILSAEKTDDGNYKILIKKEEKKKELGVSVDIDEVFIINMTGTGNAEKAYATFMMTEVA
QNMKLKPTIFLMFDGASLALKGECDKVKHPAFPKLGDKLRAALKSGVKIYVCEMSSEFRG
VDKKLEDGIEIAGAPTFFRFLSKPNARPVWL