Protein Info for MMJJ_RS05830 in Methanococcus maripaludis JJ

Annotation: 30S ribosomal protein S8e

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 TIGR00307: ribosomal protein eS8" amino acids 1 to 127 (127 residues), 142.1 bits, see alignment E=5.2e-46 PF01201: Ribosomal_S8e" amino acids 4 to 126 (123 residues), 127.2 bits, see alignment E=2.7e-41

Best Hits

Swiss-Prot: 97% identical to RS8E_METMP: 30S ribosomal protein S8e (rps8e) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K02995, small subunit ribosomal protein S8e (inferred from 96% identity to mmz:MmarC7_0930)

Predicted SEED Role

"SSU ribosomal protein S8e" in subsystem Ribosome SSU eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>MMJJ_RS05830 30S ribosomal protein S8e (Methanococcus maripaludis JJ)
MAIWQGASRRLSTGAKVWRAAKKHKREMGRPAAETQVSEVIKRKIVRCRGANLKVKLEKT
NYANVFDQANKVCKKVAVTNVIDNKANKHYIRRNVMTKGAIIETEMGKAKVTSRPGQDGV
VNAVLLTE