Protein Info for MMJJ_RS05735 in Methanococcus maripaludis JJ
Annotation: UbiA family prenyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 99% identical to DGGGP_METMP: Digeranylgeranylglyceryl phosphate synthase (MMP1677) from Methanococcus maripaludis (strain S2 / LL)
KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 99% identity to mmp:MMP1677)Predicted SEED Role
"(S)-2,3-di-O-geranylgeranylglyceryl phosphate synthase" in subsystem Archaeal lipids
KEGG Metabolic Maps
- Biosynthesis of terpenoids and steroids
- Carotenoid biosynthesis - General
- Methionine metabolism
- Porphyrin and chlorophyll metabolism
- Riboflavin metabolism
- Terpenoid biosynthesis
- Tryptophan metabolism
- Ubiquinone and menaquinone biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.5.1.-
Use Curated BLAST to search for 2.5.1.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (278 amino acids)
>MMJJ_RS05735 UbiA family prenyltransferase (Methanococcus maripaludis JJ) MDIKAYFELIRLKNCLTASFGAFIGGLIASYFNLAMVDNLILASIVVFLVCGFGNALNDI YDLKIDRINKPKRPIPSKRITLNNAKVFSYSLVAMGLFISLFNISCFLMAVLNSIVLQQY ASTYKKNKIIGNLIVAYLTGSVFIFGGIAVGNIDVTIMLFLCALFAMWSREIIKDYEDIE GDIKEKVISIPIKCGERSIYIAAFLLIFAIFLSPLPYLFGFFGIYYIISVVFCDLLFLLG IYKLVFNPSKMEAKKASRNIKIVTNLVLIAFLIGSLFK