Protein Info for MMJJ_RS05735 in Methanococcus maripaludis JJ

Annotation: UbiA family prenyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 278 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 60 (21 residues), see Phobius details amino acids 87 to 115 (29 residues), see Phobius details amino acids 136 to 166 (31 residues), see Phobius details amino acids 199 to 218 (20 residues), see Phobius details amino acids 224 to 246 (23 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details PF01040: UbiA" amino acids 22 to 256 (235 residues), 132.4 bits, see alignment E=9.1e-43

Best Hits

Swiss-Prot: 99% identical to DGGGP_METMP: Digeranylgeranylglyceryl phosphate synthase (MMP1677) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03179, 4-hydroxybenzoate octaprenyltransferase [EC: 2.5.1.-] (inferred from 99% identity to mmp:MMP1677)

Predicted SEED Role

"(S)-2,3-di-O-geranylgeranylglyceryl phosphate synthase" in subsystem Archaeal lipids

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (278 amino acids)

>MMJJ_RS05735 UbiA family prenyltransferase (Methanococcus maripaludis JJ)
MDIKAYFELIRLKNCLTASFGAFIGGLIASYFNLAMVDNLILASIVVFLVCGFGNALNDI
YDLKIDRINKPKRPIPSKRITLNNAKVFSYSLVAMGLFISLFNISCFLMAVLNSIVLQQY
ASTYKKNKIIGNLIVAYLTGSVFIFGGIAVGNIDVTIMLFLCALFAMWSREIIKDYEDIE
GDIKEKVISIPIKCGERSIYIAAFLLIFAIFLSPLPYLFGFFGIYYIISVVFCDLLFLLG
IYKLVFNPSKMEAKKASRNIKIVTNLVLIAFLIGSLFK