Protein Info for MMJJ_RS05670 in Methanococcus maripaludis JJ

Annotation: ferredoxin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13237: Fer4_10
  • amino acids 2 to 58 (57 residues), 32 bits, E=4.6e-11
• PF00037: Fer4
  • amino acids 3 to 24 (22 residues), 25.9 bits, E=2.9e-09
  • amino acids 42 to 63 (22 residues), 23.9 bits, E=1.2e-08
• PF12800: Fer4_4
  • amino acids 8 to 22 (15 residues), 15.4 bits, 8.8e-06
  • amino acids 44 to 59 (16 residues), 15.7 bits, 6.9e-06
• PF13187: Fer4_9
  • amino acids 9 to 62 (54 residues), 30.5 bits, E=1.4e-10
• PF12838: Fer4_7
  • amino acids 10 to 61 (52 residues), 37.4 bits, E=1.3e-12

Best Hits

Swiss-Prot: 69% identical to FER3_METJA: Uncharacterized ferredoxin MJ0146 (MJ0146) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00176, 2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC: 1.2.7.3] (inferred from 97% identity to mmz:MmarC7_0962)

MetaCyc: 98% identical to 2-oxoglutarate ferredoxin oxidoreductase delta subunit (Methanococcus maripaludis)
2-oxoglutarate synthase. [EC: 1.2.7.3]

Predicted SEED Role

"2-oxoglutarate oxidoreductase, delta subunit, putative (EC 1.2.7.3)" (EC 1.2.7.3)

MetaCyc Pathways

• incomplete reductive TCA cycle (6/7 steps found)
• reductive TCA cycle I (6/11 steps found)
• TCA cycle V (2-oxoglutarate synthase) (4/9 steps found)
• reductive TCA cycle II (5/12 steps found)
• TCA cycle VI (Helicobacter) (2/9 steps found)
• TCA cycle VII (acetate-producers) (2/9 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)

KEGG Metabolic Maps

• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.3

Use Curated BLAST to search for 1.2.7.3

Protein Sequence (68 amino acids)

>MMJJ_RS05670 ferredoxin family protein (Methanococcus maripaludis JJ)
MKIIIDENYCKGCDICIEVCPKDVYKKSETLNKKGIYPPNPVNPKECTNCQLCILECPDQ
AITVETEE