Protein Info for MMJJ_RS05620 in Methanococcus maripaludis JJ

Annotation: CoB--CoM heterodisulfide reductase iron-sulfur subunit A family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 PF13450: NAD_binding_8" amino acids 148 to 184 (37 residues), 25.3 bits, see alignment 1.1e-08 PF12797: Fer4_2" amino acids 239 to 257 (19 residues), 25.4 bits, see alignment (E = 6.5e-09) PF00037: Fer4" amino acids 240 to 259 (20 residues), 27.5 bits, see alignment (E = 1.4e-09) amino acids 578 to 600 (23 residues), 26 bits, see alignment (E = 4.3e-09) PF12800: Fer4_4" amino acids 244 to 257 (14 residues), 18.8 bits, see alignment (E = 1.1e-06) amino acids 616 to 630 (15 residues), 14 bits, see alignment (E = 4e-05) PF13187: Fer4_9" amino acids 584 to 632 (49 residues), 27.6 bits, see alignment 1.7e-09 PF12838: Fer4_7" amino acids 584 to 631 (48 residues), 35.7 bits, see alignment 6.7e-12

Best Hits

Swiss-Prot: 100% identical to HDRA_METMP: H(2)/formate:CoB-CoM heterodisulfide,ferredoxin reductase subunit A (hdrA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K03388, heterodisulfide reductase subunit A [EC: 1.8.98.1] (inferred from 100% identity to mmp:MMP1697)

MetaCyc: 100% identical to coB-CoM heterodisulfide reductase HdrA1 component (Methanococcus maripaludis)
RXN-18529 [EC: 1.8.98.6]

Predicted SEED Role

"CoB--CoM heterodisulfide reductase subunit A (EC 1.8.98.1)" in subsystem Anaerobic respiratory reductases or H2:CoM-S-S-HTP oxidoreductase or Methanogenesis (EC 1.8.98.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.98.1

Use Curated BLAST to search for 1.8.98.1 or 1.8.98.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (658 amino acids)

>MMJJ_RS05620 CoB--CoM heterodisulfide reductase iron-sulfur subunit A family protein (Methanococcus maripaludis JJ)
MSDPKVGVFVCYCGANINGAVDCEAVKDFASELDGVAVAATYPFMCADPGQGLIKDAIKE
HGLDRIVVAACTPKIHEPTFRGCLQDAGISPYYLEFVNIREHDAFVHMGDVEGATRKACE
MIAGGVERAKKLEDVPQKVVDVDKSCMVIGAGIAGIQSALDLGDQGFKVYLVDKDESIGG
RMAQLAKTFPTDDCAMUILAPKMVSAANHPNIELITFAEIKNIDGYIGNFDVTLEKKPRY
VDEDTCTGCGACAAACPIEVPNEFDLGLGTRKAIYVPFPQAVPLLYTIDKEHCIDCGLCA
KVCCAEAVRYDQKPQELNIKVGTIITATGYDEFDATKKEEYGYGVYDNVITTLEVERMIN
PAGPTHGHEIRPSDGKAPKRTVYIQCVGSRDEKVGNPYCSRVCCMFALKNAQLMKMHDPN
AEVYICYMDIRAFGKGYEEYYKRAQDQFGVKFIRGRPANIFEDPETKNLTVRVEDTLMGE
ILEIDADLVVLSAGLEAKKDAGELAKMLGIDRGPEGFFKELHPKLAPVNTKVDGIAIAGV
AQGPKDIPDTVAQAKGAASAVAIPMSQGQFKIEMIRATVNEEVCGGCKVCALMCPYNAIT
YEEKDGHLVAITDDVACKGCGACAAACPSGAMQLRYYRDEQVIGMIDGILNAAKMLEE