Protein Info for MMJJ_RS05565 in Methanococcus maripaludis JJ

Annotation: translation initiation factor IF-2 subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF00575: S1" amino acids 6 to 80 (75 residues), 55.3 bits, see alignment E=7.3e-19 PF07541: EIF_2_alpha" amino acids 119 to 232 (114 residues), 111 bits, see alignment E=3.2e-36

Best Hits

Swiss-Prot: 66% identical to IF2A_METJA: Translation initiation factor 2 subunit alpha (eif2a) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K03237, translation initiation factor 2 subunit 1 (inferred from 100% identity to mmp:MMP1707)

Predicted SEED Role

"Eukaryotic translation initiation factor 2 alpha subunit" in subsystem Translation initiation factors eukaryotic and archaeal

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (265 amino acids)

>MMJJ_RS05565 translation initiation factor IF-2 subunit alpha (Methanococcus maripaludis JJ)
MRNDFPEEGDIIIGNVIDVKSFGAFIELLEYPGKEGMVHISEVSSGWIKNIRDHIKKGQR
VVAKVMRVTPHKNQIDLSLKRATDQQKKVKVQEWKRFQRAEKLLQFASEKLGKTIEEGWE
AAGYPLIDEFGELYDAFESIVIEGKEVLDELETPLPQEWADVIYEIASENIELSSVKVSG
IVTLTTTEPTGVKIIKNGLKKALKANPYEDVEVNITYIGAPKYRVEVLSPDYKSGEDVLR
RVSEEAIDFIKKHAGGTGSFVRVEE