Protein Info for MMJJ_RS05445 in Methanococcus maripaludis JJ

Annotation: 2-oxoacid:acceptor oxidoreductase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF01855: POR_N" amino acids 15 to 246 (232 residues), 248.8 bits, see alignment E=6e-78 PF17147: PFOR_II" amino acids 270 to 359 (90 residues), 63.9 bits, see alignment E=1.5e-21

Best Hits

Swiss-Prot: 74% identical to KORA_METJA: 2-oxoglutarate synthase subunit KorA (korA) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00174, 2-oxoglutarate ferredoxin oxidoreductase subunit alpha [EC: 1.2.7.3] (inferred from 98% identity to mmp:MMP0003)

MetaCyc: 98% identical to 2-oxoglutarate ferredoxin oxidoreductase alpha subunit (Methanococcus maripaludis)
2-oxoglutarate synthase. [EC: 1.2.7.3]

Predicted SEED Role

"2-oxoglutarate oxidoreductase, alpha subunit (EC 1.2.7.3)" (EC 1.2.7.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.2.7.3

Use Curated BLAST to search for 1.2.7.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>MMJJ_RS05445 2-oxoacid:acceptor oxidoreductase subunit alpha (Methanococcus maripaludis JJ)
MTKVNFMQGNMACVEGAIKAGCKFFGGYPITPSTEIAEGMAKRLPKIGGFYSQMEDEIAS
IASIIGASWAGTKSMTATSGPGMSLMLENIGYAYMTETPCVLVNVQRGGPSTGQPTAAAQ
GDMMQVRWGSHGDYEPIALCPSSVQEMYDFTILAFNYAEKYRIPVFVMADEILGHMREKV
VLHDDIEILNREKPEEKPCTKPYPFGKEVPPMPTFGEGYNIHVTGLTHGENGYPDVSAET
HDKLVRRICNKILENKDDIVLYEGKYMDSETMFICYGTPSRTVKHTVETLREQGQDVGYI
RLKTVFPFPDKLIAGLKASKIIVPEMNLGQISGEVMKYAKCEVVGCGKIGGELHRPEDLK
ELI