Protein Info for MMJJ_RS05425 in Methanococcus maripaludis JJ

Annotation: geranylgeranylglyceryl/heptaprenylglyceryl phosphate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF01884: PcrB" amino acids 14 to 240 (227 residues), 242.1 bits, see alignment E=5.2e-76 TIGR01769: phosphoglycerol geranylgeranyltransferase" amino acids 23 to 225 (203 residues), 272.8 bits, see alignment E=2e-85 TIGR01768: geranylgeranylglyceryl phosphate synthase family protein" amino acids 24 to 237 (214 residues), 186 bits, see alignment E=7.1e-59 PF00977: His_biosynth" amino acids 186 to 244 (59 residues), 25.2 bits, see alignment E=1e-09

Best Hits

Swiss-Prot: 99% identical to GGGPS_METMP: Geranylgeranylglyceryl phosphate synthase (MMP0007) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K07094, putative glycerol-1-phosphate prenyltransferase [EC: 2.5.1.-] (inferred from 99% identity to mmp:MMP0007)

MetaCyc: 41% identical to phosphoglycerol geranylgeranyltransferase (Methanothermobacter thermautotrophicus Delta H)
Phosphoglycerol geranylgeranyltransferase. [EC: 2.5.1.41]

Predicted SEED Role

"(S)-3-O-geranylgeranylglyceryl phosphate synthase" in subsystem Archaeal lipids

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.- or 2.5.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>MMJJ_RS05425 geranylgeranylglyceryl/heptaprenylglyceryl phosphate synthase (Methanococcus maripaludis JJ)
MQIKLGEIESKLNKIIEEEGAAYFVLIDPDEKNYREIANHVKDYADAIIIGGSIGIINLD
EVTKDIKEITGLPIILFPGNVDGVTKEADAVFFMSLMNSKNTYWNMTAPTLGALTIKKYG
LETLPMAYLGIEPISRTAVGFVGEVNEIPQKKPEIAGLYSLSASYFGMRWAYLEAGSGAE
YPVSNEMVGISKKLSGINIIVGGGIRTPEVAYEKVMSGADVIVTGTLTEKDPQAVVEMKK
AIKKAGLDKLKMLSKK