Protein Info for MMJJ_RS05060 in Methanococcus maripaludis JJ

Annotation: argininosuccinate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 397 PF06508: QueC" amino acids 6 to 122 (117 residues), 23.5 bits, see alignment E=5.6e-09 PF00764: Arginosuc_synth" amino acids 6 to 165 (160 residues), 246.9 bits, see alignment E=1.5e-77 TIGR00032: argininosuccinate synthase" amino acids 6 to 393 (388 residues), 573.7 bits, see alignment E=1.3e-176 PF20979: Arginosuc_syn_C" amino acids 174 to 391 (218 residues), 317.7 bits, see alignment E=5.9e-99

Best Hits

Swiss-Prot: 99% identical to ASSY_METMP: Argininosuccinate synthase (argG) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01940, argininosuccinate synthase [EC: 6.3.4.5] (inferred from 99% identity to mmp:MMP0073)

Predicted SEED Role

"Argininosuccinate synthase (EC 6.3.4.5)" in subsystem Arginine Biosynthesis extended (EC 6.3.4.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (397 amino acids)

>MMJJ_RS05060 argininosuccinate synthase (Methanococcus maripaludis JJ)
MQEKIAVLAYSGGLDTSCCLKLLEDKYDYKVISVAVDVGQPEDDLKEPEEKAKKFGVLKH
YTIDAKEEFAKDYIFRAIKANALYEGYPLSTALARPLIAIKIAELAQEVGASAISHGCTG
KGNDQFRFESVMRAKTPEIEIVAPIRDLNLTRTEEIAYAKEKGIPVPVDLEKPFSIDENL
WGRSIEGGILEDPMTETPKECFAWTVDPTDAQDKEEYVEIEFEEGVPVAINGDSLEAVSL
IRKANEIAGRNGVGRVDIVEDRVLGLKSRENYECPGAMLLITAHKALEQLVLTREELVFK
EMVDAKYADLVYKGLWHEPLRLDLDAFIDKTQTRMNGKVVLKLYKGSMRIAGRESKDAIY
NEEMVSFENKEMDQREIVGMVKFHGLQAAIYEGLTRK