Protein Info for MMJJ_RS05030 in Methanococcus maripaludis JJ

Annotation: orotate phosphoribosyltransferase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 205 PF00156: Pribosyltran" amino acids 63 to 175 (113 residues), 59.5 bits, see alignment E=1.3e-20

Best Hits

Swiss-Prot: 100% identical to PYREL_METMP: PyrE-like protein (MMP0079) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 100% identity to mmp:MMP0079)

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.4.2.10

Use Curated BLAST to search for 2.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (205 amino acids)

>MMJJ_RS05030 orotate phosphoribosyltransferase-like protein (Methanococcus maripaludis JJ)
MKKELILKALKLRDMGFPSGDIAEELNISVKTALYLTLNGEELLKAEESPKEDSEKLDIF
LEWDNVRASSRRLRNISKIICDMLSDVEFDGVVGISSGGVPLATLISDELDKNFSIYVPK
KHIHTEKEKTTGFIGQNMSSIVGKDVIIVDDVMTSGNSVKETIKYLKGIANPKKVFVVMD
KSGIDEIEGVSIEHLFRTGVVDIKK