Protein Info for MMJJ_RS05000 in Methanococcus maripaludis JJ

Annotation: mRNA surveillance protein pelota

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 PF26356: Pelota_N" amino acids 1 to 125 (125 residues), 114.8 bits, see alignment E=3.9e-37 TIGR00111: mRNA surveillance protein pelota" amino acids 1 to 347 (347 residues), 387.9 bits, see alignment E=2.6e-120 PF03464: eRF1_2" amino acids 134 to 241 (108 residues), 28.4 bits, see alignment E=2.7e-10 PF03465: eRF1_3" amino acids 253 to 347 (95 residues), 88.6 bits, see alignment E=5.5e-29

Best Hits

Swiss-Prot: 99% identical to PELO_METMP: Protein pelota homolog (pelA) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K06965, protein pelota (inferred from 99% identity to mmp:MMP0085)

Predicted SEED Role

"putative cell division protein [Pyrobaculum aerophilum]; COG1537: Predicted RNA-binding proteins"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>MMJJ_RS05000 mRNA surveillance protein pelota (Methanococcus maripaludis JJ)
MKIIQEIPEKNIIKLIPENLDDLWHLSHIIQPYNAIYAVTERRTEDKGDKLRADRGTKRR
VFLGIKAEKINFHEDFNRLRVSGKIIHAPDDIPIGSYHTIDIEPLLQVSVQKNWKKWDIE
RLKEAEDSSKKPKVVVVIMDDSEADIFLVREFGIKELASIKSGVSKKLDYKQNEQAKFSY
YSDIINSISEFEGKILFAGPGFGKNNIQNYISEKYKSLAPNVVVESANHTGKSGLSEILK
SGIIDKIYGEARISKETQVVEKLLEEISKKGLAAYGIESVNNAMNFSAIDTLLLTDEYLR
RNRRSVENLMNSVENINGNIIIVSTEHDAGKQLKALGGISALLRFPIE