Protein Info for MMJJ_RS04845 in Methanococcus maripaludis JJ

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF13531: SBP_bac_11" amino acids 40 to 288 (249 residues), 50.8 bits, see alignment E=4e-17 PF01547: SBP_bac_1" amino acids 46 to 284 (239 residues), 80.8 bits, see alignment E=3.8e-26 PF13416: SBP_bac_8" amino acids 49 to 298 (250 residues), 84.3 bits, see alignment E=2.7e-27 PF13343: SBP_bac_6" amino acids 82 to 320 (239 residues), 82.9 bits, see alignment E=5.2e-27

Best Hits

KEGG orthology group: K02012, iron(III) transport system substrate-binding protein (inferred from 98% identity to mmp:MMP0108)

Predicted SEED Role

"Ferric iron ABC transporter, iron-binding protein" in subsystem Campylobacter Iron Metabolism or Iron acquisition in Vibrio or Transport of Iron

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (343 amino acids)

>MMJJ_RS04845 ABC transporter substrate-binding protein (Methanococcus maripaludis JJ)
MKNLKGILAIFCVMAVLVFAGCTEQQASNVSQEEQVVTVYVAYGSLDLIADEFEKDTGIK
MEYVSLSSGEALSRLKAEQSNPSADVWLGGGIDAFISAQQDGLLEAYKSPNAKDIDPLFV
EEDGYWTGVSLVTIGILENTDLLSEKGLPQPQTWDDLITDDYKGELIASNPTVSGTAYFT
ICGILQMYGEDEGWNYLDKFYQNTPFLTKRGSGPGNLVTAGEYAYGVAPDPHTTLIADSE
LPVKSAFLNKVIWWPSPVSIVNGAKHPENAKIFVDWCLSKEGQEVLMQASPRVPVRGDIE
VIDGVPNPKDLDFLDMDFMYWGENRDRILDEWESRYREISTTE