Protein Info for MMJJ_RS04675 in Methanococcus maripaludis JJ

Annotation: thiamine pyrophosphate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02776: TPP_enzyme_N
  • amino acids 1 to 113 (113 residues), 118.1 bits, E=2.9e-38
• PF00205: TPP_enzyme_M
  • amino acids 187 to 274 (88 residues), 50.6 bits, E=2.5e-17
• PF02775: TPP_enzyme_C
  • amino acids 352 to 488 (137 residues), 102.4 bits, E=3.2e-33

Best Hits

KEGG orthology group: K01652, acetolactate synthase I/II/III large subunit [EC: 2.2.1.6] (inferred from 92% identity to mmx:MmarC6_0810)

Predicted SEED Role

"pyruvate + formaldehyde -> hydroxyacetone + carbon dioxide, thiamine pyrophosphate-dependent"

MetaCyc Pathways

• superpathway of branched chain amino acid biosynthesis (16/17 steps found)
• superpathway of L-isoleucine biosynthesis I (12/13 steps found)
• L-isoleucine biosynthesis II (8/8 steps found)
• L-valine biosynthesis (4/4 steps found)
• L-isoleucine biosynthesis I (from threonine) (6/7 steps found)
• L-isoleucine biosynthesis IV (5/6 steps found)
• pyruvate fermentation to (R)-acetoin II (2/2 steps found)
• pyruvate fermentation to (R)-acetoin I (2/3 steps found)
• pyruvate fermentation to (S)-acetoin (2/3 steps found)
• pyruvate fermentation to isobutanol (engineered) (3/5 steps found)
• superpathway of (R,R)-butanediol biosynthesis (3/5 steps found)
• L-isoleucine biosynthesis III (4/7 steps found)
• superpathway of 2,3-butanediol biosynthesis (2/6 steps found)
• superpathway of L-threonine metabolism (8/18 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Butanoate metabolism
• C5-Branched dibasic acid metabolism
• Pantothenate and CoA biosynthesis
• Valine, leucine and isoleucine biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.2.1.6

Use Curated BLAST to search for 2.2.1.6

Protein Sequence (501 amino acids)

>MMJJ_RS04675 thiamine pyrophosphate-binding protein (Methanococcus maripaludis JJ)
MKYLDFMIDFFENKGVKSVFAYPGEQILPIYRALHENSKINCIDVKHEQASAHAADGYFR
ITNEVGICLATAGPGATNLTTGIATAFKDSSSILALTGRCSTNYIEKNYFQEIPMDFLNF
EKGYFVENAESKYLINSYNDSYEIKKPISLNIPADIYNKEVIDSKLDLANKNNGSVETAI
STIKKHKNAKNPVLLIGQGIYGNLKYSEMIEIGEILKKLQIPIITTYPTRGVIDENFENA
YGMVGRRGSLKSNELILKSDAVFSIGASLSYNTLPESIRDKILYNVIPLNLGINSTNDIK
TIVNTFNENVSSGHVKPSGQNLSRNEFKFGDYSTKIHEILENLPKDTIITTDAGNHTVFV
SLLKKCVAPRNIISSHSMGTMGFGLPASIGVKFGCNDYNINREVVSISGDGGFQMNIQEL
GTVAENNLKILIVVMKNNHLNMFGKINTPDFNKIADAYGIENVYIQNSDEIGENVSYFLK
KSIPYVMVVECENEILPKPFI