Protein Info for MMJJ_RS04625 in Methanococcus maripaludis JJ

Annotation: SLC13 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 34 to 52 (19 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 89 to 105 (17 residues), see Phobius details amino acids 125 to 142 (18 residues), see Phobius details amino acids 148 to 164 (17 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 207 to 228 (22 residues), see Phobius details amino acids 256 to 291 (36 residues), see Phobius details amino acids 303 to 330 (28 residues), see Phobius details amino acids 334 to 356 (23 residues), see Phobius details amino acids 358 to 379 (22 residues), see Phobius details amino acids 386 to 404 (19 residues), see Phobius details amino acids 424 to 444 (21 residues), see Phobius details PF00939: Na_sulph_symp" amino acids 28 to 134 (107 residues), 37 bits, see alignment E=2.2e-13 amino acids 278 to 444 (167 residues), 48.7 bits, see alignment E=6.1e-17 PF03600: CitMHS" amino acids 48 to 393 (346 residues), 246.4 bits, see alignment E=4.3e-77

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmp:MMP0152)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (446 amino acids)

>MMJJ_RS04625 SLC13 family permease (Methanococcus maripaludis JJ)
MKKALILLVLAVFLIGFTKIAYVDEESADGINSQKAIITLIILGTAAVLFFTEALPLPVT
AMLVPVALSFPGIDILSSSRAFADFGNKWVVLFMAAFILGEAVFRTGFADKIGQLTVKAA
GKSQLKLMLLVMLAIGTMSAFLSNTGTTAAFIPIVMGICVSASLKPGKLLIPMAYAASLG
GTLTLIGTPPNGLVNDALEKSGIAPFGFFEFAKIGILIFIVGILYYGTIGHKLLPESKAK
AKDFVSDTLKYRTNKMWIATLVFTFVVLMTATGTIPLVTAFMLGACMVVMTGCITMQEAF
NSISWTTIFLFAGMLPLGSAMAATGAATMIANTVITYVHSPLALLAAAYVLTALITEVMS
NTATAALVMPLGIALADAFDVSAKPILMAIAVAASSCFLTPIATPPNMIILGPGGYSFKD
YAKSGWPLEILCAVVAIAVIPRIWPF