Protein Info for MMJJ_RS04580 in Methanococcus maripaludis JJ

Annotation: 2-phosphosulfolactate phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 248 PF04029: 2-ph_phosp" amino acids 15 to 239 (225 residues), 188.4 bits, see alignment E=5.6e-60 TIGR00298: 2-phosphosulfolactate phosphatase" amino acids 25 to 243 (219 residues), 291.1 bits, see alignment E=3e-91

Best Hits

KEGG orthology group: K05979, 2-phosphosulfolactate phosphatase [EC: 3.1.3.71] (inferred from 96% identity to mmp:MMP0161)

Predicted SEED Role

"2-phosphosulfolactate phosphatase (EC 3.1.3.71)" (EC 3.1.3.71)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.71

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (248 amino acids)

>MMJJ_RS04580 2-phosphosulfolactate phosphatase (Methanococcus maripaludis JJ)
MKISISFDFFGSSELQKTVDFSDYCVIVIDVLRASATICTLLDLCDKIYITGSIEKAANI
ENSIKIGERNAKKIEGFDFGNSPVELTVNRKLIKEHFENGGNIVLTTTNGTRVLENIVSD
HILIGSITNAQNVAKKAYKLAKENNKGIMLVPVHRKGNFAIEDFIGAGIIADYIFKEYDE
EIPDEKFEELIPARALTKSDWLRKIFESNSGKNLKELGYFEDLIFCTSKNTQKSVGIFDK
KSGSISSF