Protein Info for MMJJ_RS04495 in Methanococcus maripaludis JJ

Annotation: phosphoribosylformylglycinamidine synthase I

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13507: GATase_5
  • amino acids 3 to 267 (265 residues), 280.5 bits, E=1.1e-87
• TIGR01737: phosphoribosylformylglycinamidine synthase I
  • amino acids 6 to 230 (225 residues), 208.8 bits, E=3.6e-66
• PF00117: GATase
  • amino acids 18 to 103 (86 residues), 23.7 bits, E=3.4e-09

Best Hits

Swiss-Prot: 95% identical to PURQ_METMP: Phosphoribosylformylglycinamidine synthase subunit PurQ (purQ) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01952, phosphoribosylformylglycinamidine synthase [EC: 6.3.5.3] (inferred from 97% identity to mmx:MmarC6_0773)

Predicted SEED Role

"Phosphoribosylformylglycinamidine synthase, glutamine amidotransferase subunit (EC 6.3.5.3)" in subsystem De Novo Purine Biosynthesis (EC 6.3.5.3)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (17/21 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (17/26 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.3

Use Curated BLAST to search for 6.3.5.3

Protein Sequence (269 amino acids)

>MMJJ_RS04495 phosphoribosylformylglycinamidine synthase I (Methanococcus maripaludis JJ)
MVPKVLVMSGYGINCETETAHAFQKAGAETDIVHINDLIAGKKKMADYEIIMFPGGFSYG
DDTGSGNAFANKIKNNLFDDLKEFINSGKLILGICNGFQVMTNLGLFALPSTDYGERISA
LEANTNNRYECRWVHIKENESICVFTKGIDITHVPIAHGEGRFYCDEKTYLELKENKQIV
FSYCDSEGNPANGEYPLNPNGAYYDIAGICDKTGRIFGLMPHPERSLYSISEPEYQLKKE
IAKRNGDTVSEFIESNLQIFKNAVEYFNK