Protein Info for MMJJ_RS04235 in Methanococcus maripaludis JJ

Annotation: molybdate ABC transporter permease subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 221 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 83 to 104 (22 residues), see Phobius details amino acids 146 to 169 (24 residues), see Phobius details amino acids 193 to 215 (23 residues), see Phobius details TIGR02141: molybdate ABC transporter, permease protein" amino acids 10 to 214 (205 residues), 246.5 bits, see alignment E=1e-77 PF00528: BPD_transp_1" amino acids 26 to 215 (190 residues), 78.1 bits, see alignment E=3.7e-26

Best Hits

Swiss-Prot: 40% identical to YVGM_BACSU: Putative molybdenum transport system permease protein YvgM (yvgM) from Bacillus subtilis (strain 168)

KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 92% identity to mmq:MmarC5_1454)

Predicted SEED Role

"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (221 amino acids)

>MMJJ_RS04235 molybdate ABC transporter permease subunit (Methanococcus maripaludis JJ)
MDSIVFPLVLTLKISFISTFFVVIFGVILSYILARKRFYGRDILENLVTLPMVLPPTVLG
YLLALQLGKNGFIGSLIYKFTGSGILFTWQAAVIAAFIVSFPLMVKTTTAAISAVDRELE
YVSYTLGKTELQTIYKITLPLSKKGIVAGAILSFARAVGEFGATLMVAGNLPGKTNTMSL
SIYQAFQTGNYDLANVLVVLLVIMSFLTIFLTGRFVEKWKF