Protein Info for MMJJ_RS04235 in Methanococcus maripaludis JJ
Annotation: molybdate ABC transporter permease subunit
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 40% identical to YVGM_BACSU: Putative molybdenum transport system permease protein YvgM (yvgM) from Bacillus subtilis (strain 168)
KEGG orthology group: K02018, molybdate transport system permease protein (inferred from 92% identity to mmq:MmarC5_1454)Predicted SEED Role
"Molybdenum transport system permease protein ModB (TC 3.A.1.8.1)" in subsystem Molybdenum cofactor biosynthesis or Transport of Molybdenum (TC 3.A.1.8.1)
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (221 amino acids)
>MMJJ_RS04235 molybdate ABC transporter permease subunit (Methanococcus maripaludis JJ) MDSIVFPLVLTLKISFISTFFVVIFGVILSYILARKRFYGRDILENLVTLPMVLPPTVLG YLLALQLGKNGFIGSLIYKFTGSGILFTWQAAVIAAFIVSFPLMVKTTTAAISAVDRELE YVSYTLGKTELQTIYKITLPLSKKGIVAGAILSFARAVGEFGATLMVAGNLPGKTNTMSL SIYQAFQTGNYDLANVLVVLLVIMSFLTIFLTGRFVEKWKF