Protein Info for MMJJ_RS04200 in Methanococcus maripaludis JJ

Annotation: triphosphoribosyl-dephospho-CoA synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 293 transmembrane" amino acids 82 to 95 (14 residues), see Phobius details PF01874: CitG" amino acids 9 to 279 (271 residues), 218.1 bits, see alignment E=9.8e-69

Best Hits

Swiss-Prot: 69% identical to Y227_METJA: Uncharacterized protein MJ0227 (MJ0227) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K05966, triphosphoribosyl-dephospho-CoA synthase [EC: 2.7.8.25] (inferred from 97% identity to mmp:MMP0213)

Predicted SEED Role

"Triphosphoribosyl-dephospho-CoA synthetase"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (293 amino acids)

>MMJJ_RS04200 triphosphoribosyl-dephospho-CoA synthase (Methanococcus maripaludis JJ)
MKAFDIMKASQIACCFEVGSFKPGNVHKNRDYDDIKYHHFISSGIAFGDIIYEACLEKNN
IGNFIKKGVIESKKWSPTNANLGIIMLHMPIAIAASNLDKFSESQLKKETEKIIKNTTVQ
DAIEVYGAIEIALAFVNTPENGPDLKSKDAKDELIEKNLTLYDVFKISSTWDSISNEWTE
NFKISYKGYNLIKEYYEKYNNINIAVTKTFINLLSNYPDTLIARKKGIDVAKMVSEKAKE
VLNNFNEESVLEFDKFLSKEGNKLNPGTTADLIASSLLIFLLDRISNEKTILY