Protein Info for MMJJ_RS04115 in Methanococcus maripaludis JJ

Annotation: HDIG domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07514: TraI_2
  • amino acids 41 to 75 (35 residues), 26.7 bits, 2.9e-10
• TIGR00277: HDIG domain
  • amino acids 56 to 148 (93 residues), 67.9 bits, E=2.7e-23
• PF01966: HD
  • amino acids 59 to 170 (112 residues), 56.2 bits, E=4.1e-19

Best Hits

Swiss-Prot: 61% identical to MPTB_METJA: Dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase (mptB) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 99% identity to mmp:MMP0230)

MetaCyc: 61% identical to 7,8-dihydro-D-neopterin 2',3'-cyclic phosphate phosphodiesterase monomer (Methanocaldococcus jannaschii)
RXN-12356 [EC: 3.1.4.56]; 3.1.4.56 [EC: 3.1.4.56]

Predicted SEED Role

"MptB, dihydroneopterin 2’,3’-cyclic phosphate phosphodiesterase"

MetaCyc Pathways

• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis V (Pyrococcus) (3/4 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (5/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.56

Protein Sequence (228 amino acids)

>MMJJ_RS04115 HDIG domain-containing protein (Methanococcus maripaludis JJ)
MKDLIALAEEIKDEKLRKKVIEYINNPLPKHPEIESTGITIENSPASVKRHHKYPGGLLE
HTIAVTKMAVKMAEALEETYGIELNRDLLISGGILHDLMKPQNYQLKDGKFDHLSDFHLD
HLTLGIAELYRRDFPLEVIKVVASHHGDHGPVSPDSIEAWLIHHADNVDAAINDIGIRIC
QARSREFGIDDSQIYKIVTPLKLYEMRKKLGKDKLKEFLKEKLEIKDE