Protein Info for MMJJ_RS04115 in Methanococcus maripaludis JJ

Annotation: HDIG domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 228 TIGR00277: HDIG domain" amino acids 56 to 148 (93 residues), 67.9 bits, see alignment E=2.7e-23 PF01966: HD" amino acids 59 to 170 (112 residues), 56.2 bits, see alignment E=2e-19

Best Hits

Swiss-Prot: 61% identical to MPTB_METJA: Dihydroneopterin 2',3'-cyclic phosphate phosphodiesterase (mptB) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 99% identity to mmp:MMP0230)

MetaCyc: 61% identical to 7,8-dihydro-D-neopterin 2',3'-cyclic phosphate phosphodiesterase monomer (Methanocaldococcus jannaschii)
RXN-12356 [EC: 3.1.4.56]; 3.1.4.56 [EC: 3.1.4.56]

Predicted SEED Role

"MptB, dihydroneopterin 2’,3’-cyclic phosphate phosphodiesterase"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.4.56

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (228 amino acids)

>MMJJ_RS04115 HDIG domain-containing protein (Methanococcus maripaludis JJ)
MKDLIALAEEIKDEKLRKKVIEYINNPLPKHPEIESTGITIENSPASVKRHHKYPGGLLE
HTIAVTKMAVKMAEALEETYGIELNRDLLISGGILHDLMKPQNYQLKDGKFDHLSDFHLD
HLTLGIAELYRRDFPLEVIKVVASHHGDHGPVSPDSIEAWLIHHADNVDAAINDIGIRIC
QARSREFGIDDSQIYKIVTPLKLYEMRKKLGKDKLKEFLKEKLEIKDE