Protein Info for MMJJ_RS03945 in Methanococcus maripaludis JJ

Annotation: mechanosensitive ion channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 54 to 75 (22 residues), see Phobius details amino acids 93 to 118 (26 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details amino acids 160 to 160 (1 residues), see Phobius details amino acids 162 to 181 (20 residues), see Phobius details PF21088: MS_channel_1st" amino acids 138 to 179 (42 residues), 37.9 bits, see alignment 2.1e-13 PF00924: MS_channel_2nd" amino acids 180 to 246 (67 residues), 87.4 bits, see alignment E=8.6e-29 PF21082: MS_channel_3rd" amino acids 253 to 339 (87 residues), 55.5 bits, see alignment E=9.5e-19

Best Hits

Swiss-Prot: 50% identical to MSMJS_METJA: Small-conductance mechanosensitive channel MscMJ (MJ0170) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 99% identity to mmp:MMP0264)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (351 amino acids)

>MMJJ_RS03945 mechanosensitive ion channel family protein (Methanococcus maripaludis JJ)
MALDQLYFGNTLYSYMIFLIFIFFGVFFGKVMYIFLNKYVRVLAGKTKTKLDDVILDAVE
IPLIIVVFVLFFKYGLNNLVLSGNLALWLNESLTVAITFAGVLFLLKIVDDIIVNYVVPI
VEKSENTLDDQLVPLMRKLVKFLILIAGLLLILSNVGYNISALLAGLGIGGLAVALAAKD
TIENLIAGFIIIVDRPFKLGDWIKWGGKEGIVEEVGIRSTRVRSFGDTLITVPNANIVQT
EIENFSERRKRQVKATIGLTYDTPVEKVKRAKEIIENVLNDHHGVVDPIRVSFVEFGSFS
LDLRVEYFVRDFGFDFFLNTKDEINIKIKEEFEKENIEFAFPTQTVYYKKE