Protein Info for MMJJ_RS03940 in Methanococcus maripaludis JJ

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 68 to 91 (24 residues), see Phobius details amino acids 97 to 118 (22 residues), see Phobius details amino acids 128 to 146 (19 residues), see Phobius details PF04657: DMT_YdcZ" amino acids 6 to 143 (138 residues), 118.7 bits, see alignment E=1.2e-38

Best Hits

KEGG orthology group: K09936, hypothetical protein (inferred from 99% identity to mmp:MMP0265)

Predicted SEED Role

"Integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>MMJJ_RS03940 DMT family transporter (Methanococcus maripaludis JJ)
MDKTWALIFAIVVGFVASLQPIINSKLGDHIGSKNAVFVNFIIGLVLIGLIILISDPSSI
KQLSKVPAINPVYLLGGIMGVVIVLLSLIVVPELGALSAFSIFVGVQLISGALIDHFGIF
GIQKSPITLLKLFGISLLLLGMRILIK