Protein Info for MMJJ_RS03820 in Methanococcus maripaludis JJ

Annotation: hydrogenase formation protein HypD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 360 TIGR00075: hydrogenase expression/formation protein HypD" amino acids 7 to 359 (353 residues), 524.1 bits, see alignment E=8.8e-162 PF01924: HypD" amino acids 13 to 356 (344 residues), 474.3 bits, see alignment E=1.2e-146

Best Hits

Swiss-Prot: 72% identical to Y993_METJA: Putative hydrogenase expression/formation protein MJ0993 (MJ0993) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K04654, hydrogenase expression/formation protein HypD (inferred from 99% identity to mmp:MMP0289)

Predicted SEED Role

"[NiFe] hydrogenase metallocenter assembly protein HypD" in subsystem NiFe hydrogenase maturation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (360 amino acids)

>MMJJ_RS03820 hydrogenase formation protein HypD (Methanococcus maripaludis JJ)
MDAKLMNINNKELIKKSIQTIQKLSEKLDEVKIMHVCGSHEHTICKYGIRDVLPDNITVV
PGPGCPVCVTTQKEIDKAMYLAEQGHTIATLGDMYRVPGSKKSLMQLQSEGADVKIVYGI
GDAVKLAKKQDEKVVFVAIGFETTAPTTAAELLNKPENFYILNSHRQTPPVMGFLLGGGT
SLNLDGFICPGHVSTITGLKPYYDPCKTYHAPMVVAGFEPIDVMASIVMILKQLVNGDAK
VENEYTRGVREEGNVIAQKIMNKIFEPADVAWRGFPVIKDGGMKLREEFKKYDVHENIDV
PDIKETINKACICSEILRGEKLPHDCKLFGKTCDPMNPVGSCMVSDEGTCRIFYKYSKFR