Protein Info for MMJJ_RS03795 in Methanococcus maripaludis JJ

Annotation: PQQ-binding-like beta-propeller repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF16472: DUF5050" amino acids 34 to 207 (174 residues), 37.8 bits, see alignment E=3.4e-13 amino acids 77 to 287 (211 residues), 50.8 bits, see alignment E=3.6e-17 PF13360: PQQ_2" amino acids 78 to 209 (132 residues), 63.9 bits, see alignment E=5.6e-21 amino acids 195 to 320 (126 residues), 47.5 bits, see alignment E=5.7e-16 PF25292: Beta-prop_CGLA" amino acids 111 to 167 (57 residues), 30.9 bits, see alignment E=6.3e-11

Best Hits

KEGG orthology group: None (inferred from 92% identity to mmz:MmarC7_1297)

Predicted SEED Role

"Cell surface protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>MMJJ_RS03795 PQQ-binding-like beta-propeller repeat protein (Methanococcus maripaludis JJ)
MLRGGVNDCKIKWEFLIGNSIDSSPILAKNGTIYLGSSNKNLYAINTDGSVKWFFKSGEI
IECRPSIGKDGTIYFGSDKVYAINPDGTEKWRFDTKKAIVSDFTIFEDILYVTSLDGHLY
AINPDGTEKWRFKTKKAIYATPIVSEDGTIYVGSNDNYLYAINPDGTEKWRFKTNDAITS
AASIGKDGTIYFGSDKVYAINPDGTEKWNFYAGYWTVTRPAISEDGTIYVTSLDGHLYAI
NPDGTEKWRFKTGKRIESSPVIGNTDTIYFGSYDGHLYAINPDGTEKWNFETGSWIIATP
VIDENGTIYFGTRNGKFYALFN