Protein Info for MMJJ_RS03725 in Methanococcus maripaludis JJ

Annotation: sulfurtransferase TusA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 70 PF01206: TusA" amino acids 1 to 70 (70 residues), 86.5 bits, see alignment E=4.4e-29

Best Hits

Swiss-Prot: 62% identical to Y990_METJA: Putative sulfur carrier protein MJ0990 (MJ0990) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K04085, tRNA 2-thiouridine synthesizing protein A [EC: 2.8.1.-] (inferred from 100% identity to mmp:MMP0308)

MetaCyc: 33% identical to TusA sulfur-carrier protein (Allochromatium vinosum)
2.8.1.-

Predicted SEED Role

"tRNA 5-methylaminomethyl-2-thiouridine synthase TusA"

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.-

Use Curated BLAST to search for 2.8.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (70 amino acids)

>MMJJ_RS03725 sulfurtransferase TusA family protein (Methanococcus maripaludis JJ)
MELDVTGTVCPMPVLKTKKALDSLTSGDELTVTGDYKPALQNIVRFVEDKGHEVLSTEES
SDGFKIVIKK