Protein Info for MMJJ_RS03715 in Methanococcus maripaludis JJ

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02676: TYW3
  • amino acids 5 to 189 (185 residues), 162.7 bits, E=3.9e-52

Best Hits

Swiss-Prot: 58% identical to TYW3_METJA: tRNA(Phe) 7-((3-amino-3-carboxypropyl)-4-demethylwyosine(37)-N(4))-methyltransferase (taw3) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 98% identity to mmp:MMP0310)

MetaCyc: 39% identical to tRNA isowyosine37 7-methyltransferase 1 (Pyrococcus abyssi)
RXN-14519 [EC: 2.1.1.282]; 2.1.1.- [EC: 2.1.1.282]

Predicted SEED Role

"tRNA methylase YGL050w homolog Wyeosine biosynthesis" in subsystem Wyeosine-MimG Biosynthesis

MetaCyc Pathways

• 7-(3-amino-3-carboxypropyl)-wyosine biosynthesis (1/4 steps found)
• methylwyosine biosynthesis (1/4 steps found)
• wybutosine biosynthesis (1/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.282

Protein Sequence (194 amino acids)

>MMJJ_RS03715 hypothetical protein (Methanococcus maripaludis JJ)
MFNDDKEFTLKKLQEALDNDFVDLEVMYLVDKINEFKDYYTTSSCIGRCGIIEFPKDKNP
KINSRWLGKWHHYANYDEIDEALLKKSENFEKISFVLNSPILHVASRNADTSKKLLELAY
HNGLKASSIKSISSKRYIVEIMTTAKMDAPIAYDGKMVVNREYLDILLDEGNLKLKHARK
SLNRFYDKLVELQD