Protein Info for MMJJ_RS03600 in Methanococcus maripaludis JJ

Annotation: TrmJ/YjtD family RNA methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 234 PF00588: SpoU_methylase" amino acids 3 to 153 (151 residues), 91.4 bits, see alignment E=3.1e-30 TIGR00050: RNA methyltransferase, TrmH family, group 1" amino acids 4 to 229 (226 residues), 235.8 bits, see alignment E=3e-74

Best Hits

Swiss-Prot: 60% identical to TRMJ_METJA: tRNA (cytidine-2'-O-)-methyltransferase TrmJ (trmJ) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 98% identity to mmp:MMP0334)

Predicted SEED Role

"tRNA:Cm32/Um32 methyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (234 amino acids)

>MMJJ_RS03600 TrmJ/YjtD family RNA methyltransferase (Methanococcus maripaludis JJ)
MKTVVILVNPKYGGNLGAIARNMMNFDVEELRIVGTPEILDDEAYIRAVHAKNILNNAKF
YSKLEDAISDIDFTVATTGAVCGDRNVNRVPITPRELAKKHFGINGTLGIVFGREDDGLK
NEDVELCDILVSVPTSNKYPILNLSHAVSVILYEIYFESFSEDIPYDLNMKNASVDEKNA
LLRFFNEFVDRSKDVPDYRKDICKTIFKRIVGRAFISGKEANSLICVFKDKCPK