Protein Info for MMJJ_RS03465 in Methanococcus maripaludis JJ

Annotation: restriction endonuclease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 PF17728: BsuBI_PstI_RE_N" amino acids 3 to 139 (137 residues), 162.2 bits, see alignment E=7.5e-52 PF06616: BsuBI_PstI_RE" amino acids 152 to 302 (151 residues), 198.1 bits, see alignment E=6.2e-63

Best Hits

Swiss-Prot: 51% identical to T2PS_PROST: Type-2 restriction enzyme PstI (pstIR) from Providencia stuartii

KEGG orthology group: None (inferred from 49% identity to mru:mru_1166)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (309 amino acids)

>MMJJ_RS03465 restriction endonuclease (Methanococcus maripaludis JJ)
MGKLDEALTILKKFELPVKQQNNRSAYTLLALANIQENSDWKDSEDNLVRIHDILLFISE
NYGYTYAENSRETIRRQTIHQFEHAGIVERNRDDPKRPTNSGKTVYSLTPEFLEVLKTYE
TDDFEKSVEWFLENKTSLSEKYQGIREIHKISVKVDDTELEFSSGEHNELQKEIIEEFGP
RFAGGSKVLYVGDTAHKNLYKLDEELEKLGIPMTKHDKLPDVVLYDEKNNWIYLIEAVTS
HGPVSDKRYYELEEMLEDCKCGKIYVSCFRDKATFKKYVADIAWDTEVWISENPDHMIHY
NGDRFIGPR