Protein Info for MMJJ_RS03430 in Methanococcus maripaludis JJ

Annotation: winged helix-turn-helix domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 121 PF02002: TFIIE_alpha" amino acids 9 to 93 (85 residues), 23.8 bits, see alignment E=8.7e-09 PF01022: HTH_5" amino acids 12 to 55 (44 residues), 35.2 bits, see alignment E=2.3e-12 PF09339: HTH_IclR" amino acids 12 to 55 (44 residues), 24 bits, see alignment E=6.9e-09 PF01047: MarR" amino acids 13 to 61 (49 residues), 26.8 bits, see alignment E=9.8e-10 PF12802: MarR_2" amino acids 14 to 65 (52 residues), 28.5 bits, see alignment E=3.5e-10

Best Hits

KEGG orthology group: None (inferred from 100% identity to mmx:MmarC6_0566)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (121 amino acids)

>MMJJ_RS03430 winged helix-turn-helix domain-containing protein (Methanococcus maripaludis JJ)
MFLKILSKSNAKEILMLLNEYGELYFGQIHKELDKPKSNLSRVISELQEEGLVNKRTEET
DEDGRIPKNYYSLTNLGKIAIEIYQKEDKMLKEKESGNVNINVENNHGIIANNIQNLNVK
K