Protein Info for MMJJ_RS03340 in Methanococcus maripaludis JJ

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 128 transmembrane" amino acids 17 to 39 (23 residues), see Phobius details amino acids 45 to 66 (22 residues), see Phobius details amino acids 77 to 97 (21 residues), see Phobius details amino acids 103 to 125 (23 residues), see Phobius details

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (128 amino acids)

>MMJJ_RS03340 hypothetical protein (Methanococcus maripaludis JJ)
MTQEKLFGLIDEEKGTLLLYFAGIVITFSGQGINLLSFIPGVGPLVASAYSTFGWASCVV
IGAILFGTTERIGPVKICAMIVLLLTLSEAIITATIGQIPLIGGLLVSGTGMIYLIIDVV
CLTILKFE