Protein Info for MMJJ_RS03210 in Methanococcus maripaludis JJ

Annotation: phosphoribosylamine--glycine ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00877: phosphoribosylamine--glycine ligase
  • amino acids 1 to 428 (428 residues), 475.8 bits, E=5.8e-147
• PF02844: GARS_N
  • amino acids 1 to 102 (102 residues), 82.1 bits, E=6.4e-27
• PF01071: GARS_A
  • amino acids 103 to 304 (202 residues), 205.1 bits, E=1.5e-64
• PF02843: GARS_C
  • amino acids 339 to 428 (90 residues), 63.8 bits, E=2.2e-21

Best Hits

Swiss-Prot: 99% identical to PUR2_METMP: Phosphoribosylamine--glycine ligase (purD) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01945, phosphoribosylamine--glycine ligase [EC: 6.3.4.13] (inferred from 99% identity to mmp:MMP0392)

Predicted SEED Role

"Phosphoribosylamine--glycine ligase (EC 6.3.4.13)" in subsystem De Novo Purine Biosynthesis (EC 6.3.4.13)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (35/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (17/21 steps found)
• superpathway of 5-aminoimidazole ribonucleotide biosynthesis (6/6 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis I (5/5 steps found)
• 5-aminoimidazole ribonucleotide biosynthesis II (5/5 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (17/26 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.13

Protein Sequence (444 amino acids)

>MMJJ_RS03210 phosphoribosylamine--glycine ligase (Methanococcus maripaludis JJ)
MKVLLIGGGAREHAIAMALKKNELVELYTLMKNKNPGIYALSEEVSFNNETDVPAIKEFA
EKIKPEIAVIGPESPLGVGASDLLEEMGILTVGPKKLPAQIETSKEFMRNLFKKYEIDGS
LKYAAFNDYGTELEGFIDEMTSLGKDVVVKPAGLTGGKGVKVVGEQLKDNEEAKIYAKEV
FDKSIGGGKIIIEEKLVGVEFTLHGFVDGENIVFMPAVQDHPHAYNNDEGPITGGMGSYS
CPNHGLPFLSEEMLDKAEKIMEKTVNSINLEVGPYKGFLYGQFMLTADGPKIIEYNARFG
DPEAMNLLPILKTDFLDVCFAIAEGKLDKLNLEFENKATVCKYVVPNGYPIDPVRNKELA
VDEKAIEDANAILFYASINEENGKLYITGSRSAAVVGISENIEEAEKIAQKAIENFKGEV
YYRSDIGTLDLIKKRVERVKELAK