Protein Info for MMJJ_RS03165 in Methanococcus maripaludis JJ

Annotation: methionine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01717: Meth_synt_2
  • amino acids 1 to 305 (305 residues), 149.8 bits, E=6.1e-48

Best Hits

Swiss-Prot: 62% identical to METE_METJA: Methionine synthase (metE) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K00549, 5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase [EC: 2.1.1.14] (inferred from 98% identity to mmp:MMP0401)

Predicted SEED Role

"5-methyltetrahydropteroyltriglutamate--homocysteine methyltransferase (EC 2.1.1.14)" in subsystem Methionine Biosynthesis (EC 2.1.1.14)

MetaCyc Pathways

• superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (14/15 steps found)
• superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (14/18 steps found)
• S-adenosyl-L-methionine salvage II (3/3 steps found)
• L-methionine biosynthesis II (5/6 steps found)
• aspartate superpathway (18/25 steps found)
• superpathway of S-adenosyl-L-methionine biosynthesis (6/9 steps found)
• superpathway of L-methionine biosynthesis (transsulfuration) (6/9 steps found)
• superpathway of L-homoserine and L-methionine biosynthesis (5/8 steps found)
• S-adenosyl-L-methionine salvage I (2/4 steps found)
• L-methionine biosynthesis III (2/4 steps found)
• L-methionine biosynthesis I (2/5 steps found)
• superpathway of L-methionine biosynthesis (by sulfhydrylation) (7/12 steps found)
• seleno-amino acid biosynthesis (plants) (1/5 steps found)
• superpathway of seleno-compound metabolism (3/19 steps found)

KEGG Metabolic Maps

• Biosynthesis of plant hormones
• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.14

Protein Sequence (312 amino acids)

>MMJJ_RS03165 methionine synthase (Methanococcus maripaludis JJ)
MIKTVVGSYPVVKGKPDSIPDKIKKFFGKYDKYEYSIKKALDDQLNVGIDILSDGQVRGD
MVEIFVSNMYGFEGRRVVNRVEFVKPITLNDIKYSLKYISKKDPEKGVKGIITGACTLAS
SIRVENYYADNKDENLIYDLARALNKEALSIQNHVKMIQFDEPILSTGLYDLEVAKKAMN
IITSGITVPVAMHVCGDVSKIFYKLNEFNVDILDHEFASCRKNLEVLNEITKKVGFGCIN
TKIKSVDSVDEVKALISEGIEILKNNSKFEGSINDSVIIDPDCGMRLLPVDVAYSKLNNM
VTAANEIEKDLI