Protein Info for MMJJ_RS02430 in Methanococcus maripaludis JJ

Annotation: tyrosine-type recombinase/integrase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 322 PF13495: Phage_int_SAM_4" amino acids 25 to 104 (80 residues), 44.1 bits, see alignment E=3.4e-15 PF00589: Phage_integrase" amino acids 141 to 309 (169 residues), 95.8 bits, see alignment E=4.1e-31

Best Hits

Swiss-Prot: 56% identical to Y367_METJA: Probable integrase/recombinase protein MJ0367 (MJ0367) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K04763, integrase/recombinase XerD (inferred from 63% identity to mfs:MFS40622_1099)

Predicted SEED Role

"Site-specific tyrosine recombinase" in subsystem Proteasome bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (322 amino acids)

>MMJJ_RS02430 tyrosine-type recombinase/integrase (Methanococcus maripaludis JJ)
MDIEKLISIKPKRDEVKETPQIREWLDRFREEREFDGIKKTTLRNDITRLRVFLSFVFLE
IEKTPEITNNGDFVKFFNYLEKERKLQRNTLDKYFKLLKVFYRLMRLKNFSQFEEESKER
KRYSKFEIKHYDSINADLINQVLQKIIKSSSRTKLRDAVHIRFLWDTGARLSESLNITYG
DCDFNEGLFKLRDTKGSEERMVTCSGDTLEALKHYCRFNVLQGPEDTIFQTNKGGRIVKV
GWIGQVFKSTIDELKQEGKIPKNKRIVVHSLRHGRAVDLLDQGIPIEIVKEYLGHKSIET
TLFYAHSKERQQKMIKDIKKML