Protein Info for MMJJ_RS02330 in Methanococcus maripaludis JJ

Annotation: ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 PF00005: ABC_tran" amino acids 18 to 166 (149 residues), 101.5 bits, see alignment E=1.5e-32 PF27219: MJ0874" amino acids 288 to 368 (81 residues), 74.8 bits, see alignment E=1.9e-24

Best Hits

KEGG orthology group: K02013, iron complex transport system ATP-binding protein [EC: 3.6.3.34] (inferred from 77% identity to mvn:Mevan_0128)

Predicted SEED Role

"Vitamin B12 ABC transporter, ATPase component BtuD" in subsystem Coenzyme B12 biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.34

Use Curated BLAST to search for 3.6.3.34

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (378 amino acids)

>MMJJ_RS02330 ABC transporter ATP-binding protein (Methanococcus maripaludis JJ)
MLKTENLTVGYNDYVVVENANLEIKEGEILCIIGPNGVGKSTLLKTIATYLKPKTGVVYL
NAEKIHELKPKELAKEMAVVLTDRVNPGNMTGFDIIAIGRHPYTDLFGRLSDEDKLIVTN
AAISVNAEHLLSKNFFEMSDGEKQKIMIARAIAQEPNVLILDEPTSFLDAKHKIELTLLL
RKLATEKNLAIIVTLHDIELGLRIADKMALIKDHNIIAYGYPEEIMDKKTVNSLYDLKNA
NYSNLIGYFELKNEFNDKKNGNKKVFVNCGGGSGSGVLRYLVKNGYDITVGILQKNDIDY
AVAESMELDIICEEAFCKISNEKLDEAFKELESADVFINTNYPVGDMNILNLNLVEQAQK
LGKTVINYDGNIQCLKDI