Protein Info for MMJJ_RS02135 in Methanococcus maripaludis JJ

Annotation: TatD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 PF01026: TatD_DNase" amino acids 10 to 275 (266 residues), 108.4 bits, see alignment E=2.1e-35

Best Hits

Swiss-Prot: 61% identical to Y1127_METJA: Uncharacterized protein MJ1127 (MJ1127) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K07049, TatD-related deoxyribonuclease (inferred from 96% identity to mmp:MMP0556)

Predicted SEED Role

"Uncharacterized protein MJ1127"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>MMJJ_RS02135 TatD family hydrolase (Methanococcus maripaludis JJ)
MDILKELPITDNHIHIDPINGLGPEKVAKTFKNAGGKVMIIPNKPAFSTNLTKPMDEMLS
IIEKVRENGIIAFGILGVHPAELTVMLRNGIELETAKNYMIDALDYAKNMVLENEFLIGM
GEVGRPHFEVEEKIWDVSNEILNYSMEIAKDIDCAVQIHAESASREQFKEFSEMAKSVKL
SPKKVIKHHSSDMVLEGEEFGIFPSIVASKPVDTAIEKSNRFLMETDYIDDLKRPGVVLG
IKTVPRKTRQLLENEIIDEEICFKIHKENVEKVYGIEIDF