Protein Info for MMJJ_RS01920 in Methanococcus maripaludis JJ
Annotation: phosphoglycerate mutase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 97% identity to mmp:MMP0598)Predicted SEED Role
"2,3-bisphosphoglycerate-independent phosphoglycerate mutase, archaeal type (EC 5.4.2.1)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis, including Archaeal enzymes (EC 5.4.2.1)
MetaCyc Pathways
- gluconeogenesis II (Methanobacterium thermoautotrophicum) (16/18 steps found)
- glycolysis V (Pyrococcus) (10/10 steps found)
- glycolysis II (from fructose 6-phosphate) (9/11 steps found)
- Rubisco shunt (8/10 steps found)
- glycolysis IV (8/10 steps found)
- gluconeogenesis I (10/13 steps found)
- glycolysis I (from glucose 6-phosphate) (10/13 steps found)
- glycolysis III (from glucose) (8/11 steps found)
- homolactic fermentation (8/12 steps found)
- Bifidobacterium shunt (10/15 steps found)
- glycolysis VI (from fructose) (7/11 steps found)
- superpathway of anaerobic sucrose degradation (12/19 steps found)
- superpathway of glucose and xylose degradation (10/17 steps found)
- superpathway of glycolysis and the Entner-Doudoroff pathway (10/17 steps found)
- Entner-Doudoroff pathway III (semi-phosphorylative) (4/9 steps found)
- superpathway of hexitol degradation (bacteria) (10/18 steps found)
- glycerol degradation to butanol (8/16 steps found)
- superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (12/22 steps found)
- photorespiration II (3/10 steps found)
- hexitol fermentation to lactate, formate, ethanol and acetate (9/19 steps found)
- photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (14/26 steps found)
- 1-butanol autotrophic biosynthesis (engineered) (14/27 steps found)
- superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (13/26 steps found)
- ethene biosynthesis V (engineered) (12/25 steps found)
- Methanobacterium thermoautotrophicum biosynthetic metabolism (34/56 steps found)
- superpathway of N-acetylneuraminate degradation (9/22 steps found)
KEGG Metabolic Maps
- Biosynthesis of alkaloids derived from histidine and purine
- Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
- Biosynthesis of alkaloids derived from shikimate pathway
- Biosynthesis of alkaloids derived from terpenoid and polyketide
- Biosynthesis of phenylpropanoids
- Biosynthesis of plant hormones
- Biosynthesis of terpenoids and steroids
- Glycolysis / Gluconeogenesis
Isozymes
Compare fitness of predicted isozymes for: 5.4.2.1
Use Curated BLAST to search for 5.4.2.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (archaea)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (428 amino acids)
>MMJJ_RS01920 phosphoglycerate mutase (Methanococcus maripaludis JJ) MKTIVLDFDGLLDDSYEILDNKTPLEYAKTPNFDKLVQKGSCGLLSPYKKGVPTYSVMDL FLMLGYSRDEFPGISVLRALGEDLELSDNAVYIECTFVSTIEDNYGHRVVDRASCDLTDK ELNQLMSLIPTNFEGYEFNLKTCADYGCVLSMTDKNGWISDKISDSDPYYPGRHVNKISP VYELCDSPGECKRAKSTAEALNKFLLRCHKILENHEINIKRKRKGKYPINFLITRFPGKN IDISTFYEKYGLKALSISNCRLAKGFSRFVKVDYLLTKDLSESVNSSIKYLDNYDLMYVK CCRISEGQIKDPVEKAAVIEEMDACLDKLTDLEDVLLVITSKKLSKMMGAFVNSGNEYSL IVSGKNVRKDDISEFTEKNCYIGPLRLEHDEILNLILNYMDKALLYGLRPGGYLLDYIPN DEDIEHLK