Protein Info for MMJJ_RS01595 in Methanococcus maripaludis JJ

Annotation: U32 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01136: Peptidase_U32
  • amino acids 76 to 299 (224 residues), 269.7 bits, E=8.7e-85

Best Hits

Swiss-Prot: 72% identical to Y090_METJA: Uncharacterized protease MJ0090 (MJ0090) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 94% identity to mmq:MmarC5_0916)

Predicted SEED Role

"Collagenase"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Protein Sequence (403 amino acids)

>MMJJ_RS01595 U32 family peptidase (Methanococcus maripaludis JJ)
MVELLAPARDLSGLITAFNNGADSVYCGLKEMSMRATAKNFERNELIEGINLAHDANKRV
YLCTNTVVYEDDVLNVNEILEFAKSAEVDAVIVNDIGAMSLADELGLEIHVSVQNNITNS
KTAEFFSKFAKRVVLSRELTLTQIKQIKENLKLNKVDLELEGFIHGALCTAMSGRCYLSS
YLFNRNANCGDCLQPCRRSWKLVNEHADGTHELICEGKYLLSPKDLCMIEHIPEMIDVFD
CFKIEGRAKNVDYVMRATKTYRNAIDSVIDGTYEEKLPLFKKELDKIYNRGYDTGFYFRD
IACNHDLQYEFEGNISPYKKIEVGKVVNYFKKVDVAEITLIDDLNVGDSVLIIGQTTGCI
EEKIESMQVEGENITTAKKGQNVGIKLENLVRENDKVYILKED