Protein Info for MMJJ_RS01435 in Methanococcus maripaludis JJ

Annotation: 4Fe-4S binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 51 to 75 (25 residues), see Phobius details amino acids 104 to 125 (22 residues), see Phobius details amino acids 131 to 157 (27 residues), see Phobius details amino acids 164 to 181 (18 residues), see Phobius details PF12801: Fer4_5" amino acids 51 to 85 (35 residues), 45.1 bits, see alignment 4.1e-16 amino acids 143 to 184 (42 residues), 22.1 bits, see alignment 6e-09

Best Hits

Swiss-Prot: 47% identical to Y750_METJA: Uncharacterized protein MJ0750 (MJ0750) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 97% identity to mmp:MMP0690)

Predicted SEED Role

"Uncharacterized polyferredoxin MJ0750"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>MMJJ_RS01435 4Fe-4S binding protein (Methanococcus maripaludis JJ)
MKISFQLIRNLIKTSFLGYFLVNNSFCLCIVGFVQRILLTFNLSEITPQLIGLSAVSVVF
GRLFCGFICPFGIIFEWTYKLKMKIDNSKILPKVDPKIHNKLIYLKYILLIIGLYLTFKY
ATYVICGVCPIGSFAGLNGTVISFILLGLFIILGYFIPMFFCRYFCPIGALLGILSVKPV
FKIKSNDKCNTCRLCEKKCPMQINILDNMDEKECIRCFQCVTACKKGGITYGR