Protein Info for MMJJ_RS01375 in Methanococcus maripaludis JJ

Annotation: tetrahydromethanopterin:alpha-L-glutamate ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00768: alpha-L-glutamate ligase, RimK family
  • amino acids 4 to 284 (281 residues), 233.3 bits, E=1.8e-73
• PF08443: RimK
  • amino acids 96 to 283 (188 residues), 114.2 bits, E=8.7e-37
• PF02955: GSH-S_ATP
  • amino acids 113 to 271 (159 residues), 46.8 bits, E=3.6e-16

Best Hits

Swiss-Prot: 98% identical to MPTN_METMP: Tetrahydromethanopterin:alpha-L-glutamate ligase (mptN) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K05844, ribosomal protein S6 modification protein (inferred from 98% identity to mmp:MMP0702)

MetaCyc: 49% identical to tetrahydrosarcinapterin synthase monomer (Methanocaldococcus jannaschii)
RXN-11103 [EC: 6.3.2.33]

Predicted SEED Role

"Tetrahydromethanopterin:alpha-L-glutamate ligase"

MetaCyc Pathways

• tetrahydrosarcinapterin biosynthesis (1/1 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.2.33

Protein Sequence (292 amino acids)

>MMJJ_RS01375 tetrahydromethanopterin:alpha-L-glutamate ligase (Methanococcus maripaludis JJ)
MRMGIISEERDWVTDELKSKMEKNDIGPVIIQPSKIISYIESEVKFEQNNRSILDLKCAF
VRNIGEGVEMFHRFDMLKYLENYVPVINPMDGIENAGNKFRTSFLMEVHKIPHPKTIVAE
DVNKALIAADKFEDVVLKPLFGNQGKGLVRVKGRSTVAKLKALNTFKSTHGVIYMQEFVN
NPNNVYRDIRAFAVGDKVISAMYRTSDNWITNIHQNGVPEKCEITEELSKIVLAAKDAVG
LVYAGVDILESSDGLKVIEVNACPSWEGLSRISDVDIAQNLIDEALNYANGY