Protein Info for MMJJ_RS01360 in Methanococcus maripaludis JJ

Annotation: UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR00236: UDP-N-acetylglucosamine 2-epimerase" amino acids 3 to 360 (358 residues), 454.4 bits, see alignment E=1.5e-140 PF02350: Epimerase_2" amino acids 30 to 360 (331 residues), 391.8 bits, see alignment E=1.2e-121

Best Hits

Swiss-Prot: 97% identical to WECB_METMP: UDP-N-acetylglucosamine 2-epimerase (wecB) from Methanococcus maripaludis (strain S2 / LL)

KEGG orthology group: K01791, UDP-N-acetylglucosamine 2-epimerase [EC: 5.1.3.14] (inferred from 97% identity to mmp:MMP0705)

Predicted SEED Role

"UDP-N-acetylglucosamine 2-epimerase (EC 5.1.3.14)" in subsystem CMP-N-acetylneuraminate Biosynthesis or Sialic Acid Metabolism (EC 5.1.3.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.3.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (archaea)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (366 amino acids)

>MMJJ_RS01360 UDP-N-acetylglucosamine 2-epimerase (non-hydrolyzing) (Methanococcus maripaludis JJ)
MYKIGIILGTRPEIIKMSPVIRELTTKNFFLIHTNQHYSENMDKIFFEELNLKKPDYNLN
IGSGSHGDQTGRMLMEIEKVLLKEKPDFVLVQGDTNTVLAGALAASKLGVKIGHIEAGLR
SFDRKMPEETNRVLTDHISEFLFAPTKTASNNILKEGISGEKIHIVGNTIVDATIQNLKI
AEKNEKVCKFISEITKNEKYFLLTLHRAENTDNFEILSKLVTSINNISKKYEKNIIFPIH
PRTHKKLNEFGLINALENNPLIKIIEPVGYLEFLGLEKNAELIITDSGGLQEEACILNVP
CVTLRENTERPETLDVNSNILAGSNPENILNCIEKMLKSNRHWNNPFGDGNSGKNIVNIV
FGEKKP